PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F00325.1.p
Common NameEUGRSUZ_F00325, LOC104447949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 358aa    MW: 39207.8 Da    PI: 6.6417
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F00325.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W+ eEd++l+d ++q+G g+W + +++ g++R++k+c++rw +yl
  Eucgr.F00325.1.p 14 KGPWSSEEDKKLLDFIQQHGHGSWISLPKRAGLNRCGKSCRLRWINYL 61
                      79********************************************97 PP

2Myb_DNA-binding53.45.8e-1767112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.F00325.1.p  67 RGSFSPEEEQTILHLHSVLGNK-WSAIATRLP-GRTDNEIKNYWNTHL 112
                       899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129415.468961IPR017930Myb domain
SuperFamilySSF466892.91E-3011108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
CDDcd001671.47E-101661No hitNo description
PROSITE profilePS5129427.18862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-2865117IPR009057Homeodomain-like
SMARTSM007173.1E-1666114IPR001005SANT/Myb domain
PfamPF002494.5E-1667112IPR001005SANT/Myb domain
CDDcd001673.60E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGRSPCCEGN GLKKGPWSSE EDKKLLDFIQ QHGHGSWISL PKRAGLNRCG KSCRLRWINY  60
LRPDIKRGSF SPEEEQTILH LHSVLGNKWS AIATRLPGRT DNEIKNYWNT HLKKKLIRMG  120
FDPVTHRRRT DVFSSSLSQL IALANLSKLI DSRPLDESAL ALQSDALQLA NSLQYLQGLL  180
QPPASATASN NNLFSQTSCI TEATQGYTAY DPIKEDPDLN SLLSSTARLF SEGIASFSQP  240
LQDNNFIAHH HLVPNYLTNT PPQVPFSFQT SLNNHVDRTA ATQCLSMVNG IDHCLDSTDS  300
ALWGDYDDLD LLLPPSLTEA SAVTDRGDAR SGGSSGGSPS SSTSPWSDIF FGDLAGH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F00325.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010060001.10.0PREDICTED: myb-related protein 330-like
SwissprotQ8GWP01e-66MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A059BKY50.0A0A059BKY5_EUCGR; Uncharacterized protein
STRINGPOPTR_0005s17080.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3418522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-89myb domain protein 93